PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010108641.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Trihelix
Protein Properties Length: 611aa    MW: 68941 Da    PI: 6.5192
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010108641.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.32.8e-3082166187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++qe+laL+++r++m+ ++r+++lk+plWeevs+k++e g++rs k+Ckek+en+ k+++++k+g+ +++  + +t+++fdqlea
  XP_010108641.1  82 RWPRQETLALLKIRSDMDATFRDSSLKAPLWEEVSRKLAELGYKRSGKKCKEKFENVYKYHRRTKDGRTGKS--DGKTYRFFDQLEA 166
                     8********************************************************************964..5557*******85 PP

2trihelix101.85.3e-32428513187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev aLi++r++++ +++++  k+plWe++s+ mr+ g+ rs+k+Ckekwen+nk++kk+k+++kkr s++s+tcpyf+ql+a
  XP_010108641.1 428 RWPKAEVEALINLRTNLDLKYEENVPKGPLWEDISAGMRRLGYDRSSKRCKEKWENINKYFKKVKDSDKKR-SDDSKTCPYFHQLDA 513
                     8*********************************************************************8.89999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.65475139IPR017877Myb-like domain
SMARTSM007170.001679141IPR001005SANT/Myb domain
PfamPF138371.1E-1980166No hitNo description
CDDcd122032.00E-2481146No hitNo description
SMARTSM007171.2425487IPR001005SANT/Myb domain
PfamPF138375.9E-22427514No hitNo description
PROSITE profilePS500907.271427485IPR017877Myb-like domain
CDDcd122035.42E-23430492No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MGDASTTATG SAFGSSGEAA AAAAAEEDRH EEVLLRHEEN GDGDGNGAGS AFLVNNSAEE  60
DDKEDRNVED GGDRSDNFGR NRWPRQETLA LLKIRSDMDA TFRDSSLKAP LWEEVSRKLA  120
ELGYKRSGKK CKEKFENVYK YHRRTKDGRT GKSDGKTYRF FDQLEAFDQN HHPPPPPLQA  180
AAKVPHQAIT NPPISTNVSH NIFVNPNPTS NNISITLPPP PPPPTSTTSN SLPSPQTIIT  240
KSMITNHNNN INGLLFSSPT SSSTASDEEF QARHKRKRKW RDFFRRLTRE VVRKQEEMHK  300
RFLETVAKCE HERTAREEAW RLQEMARINR EHEILLQERS AATAKDAALI AFLQKVSGVT  360
QNLQIISTDN VALSVLNNSI NNNHHNNNTN NHTISLPAPQ PAAKQAATAA PPHVRSLSTT  420
SSSSWSSRWP KAEVEALINL RTNLDLKYEE NVPKGPLWED ISAGMRRLGY DRSSKRCKEK  480
WENINKYFKK VKDSDKKRSD DSKTCPYFHQ LDAIYREKLK NIDPKAQENG APHPQQPPPH  540
FGMEPLMVQP ERQWPLQEEE YDQEEEVDRD TSSSTEVEDQ DHDDHDNHRE GTGDGSYGIV  600
SNVQSSMDMV E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124132KRSGKKCKE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071393e-35AK107139.1 Oryza sativa Japonica Group cDNA clone:002-124-D01, full insert sequence.
GenBankAL6065873e-35AL606587.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0011L07, complete sequence.
GenBankAP0149603e-35AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126123e-35CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8551973e-35CR855197.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: H0115B09, complete sequence.
GenBankX682613e-35X68261.1 O.sativa gt-2 gene.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108641.10.0Trihelix transcription factor GT-2
SwissprotQ391171e-138TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLW9S0350.0W9S035_9R
STRINGPOPTR_0002s06900.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-70Trihelix family protein